Psmg2 Peptide - middle region
Psmg2 Peptide - middle region
Product Specifications
Product Name Alternative
1700017I17Rik, AW545363, Clast3, Tnfsf5ip1
UniProt
Q9EST4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Psmg2 Rabbit Polyclonal Antibody (orb586886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598899
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1125800-01 0.02 mg (E-Coli)
Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein G (outG)
Sign In for Pricing
View Details MBS1125800-02 0.1 mg (E-Coli)
Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein G (outG)
Sign In for Pricing
View Details MBS1125800-03 0.02 mg (Yeast)
Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein G (outG)
Sign In for Pricing
View Details MBS1125800-04 0.1 mg (Yeast)
Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein G (outG)
Sign In for Pricing
View Details MBS1125800-05 0.02 mg (Baculovirus)
Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein G (outG)
Sign In for Pricing
View Details