Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc85a Peptide - middle region

Ccdc85a Peptide - middle region

Product Specifications

Product Name Alternative

RGD1311700

UniProt

D4ACT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc85a Rabbit Polyclonal Antibody (orb326745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178482

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-01 0.1 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-02 0.2 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-03 0.5 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-04 1 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-05 5 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Histone H4 (H4)
MBS2115477-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Histone H4 (H4)

Sign In for Pricing
View Details