Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc85a Peptide - middle region

Ccdc85a Peptide - middle region

Product Specifications

Product Name Alternative

RGD1311700

UniProt

D4ACT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc85a Rabbit Polyclonal Antibody (orb326745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001178482

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK5 Rabbit mAb Antibody
orb1951389-01 50 µL

MEK5 Rabbit mAb Antibody

Sign In for Pricing
View Details
MEK5 Rabbit mAb Antibody
orb1951389-02 100 µL

MEK5 Rabbit mAb Antibody

Sign In for Pricing
View Details
(Rac) -ABT-202 dihydrochloride
orb1309180-01 1 mg

(Rac) -ABT-202 dihydrochloride

Sign In for Pricing
View Details
(Rac) -ABT-202 dihydrochloride
orb1309180-02 5 mg

(Rac) -ABT-202 dihydrochloride

Sign In for Pricing
View Details
(Rac) -ABT-202 dihydrochloride
orb1309180-03 1 ml x 10 mM (in DMSO)

(Rac) -ABT-202 dihydrochloride

Sign In for Pricing
View Details
(Rac) -ABT-202 dihydrochloride
orb1309180-04 10 mg

(Rac) -ABT-202 dihydrochloride

Sign In for Pricing
View Details