Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tpgs1 Peptide - middle region

Tpgs1 Peptide - middle region

Product Specifications

Product Name Alternative

AV005629, Gtrgeo22, PGs1, Tpgs1

UniProt

Q99MS8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tpgs1 Rabbit Polyclonal Antibody (orb587186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683736

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3946005 3x 1.0 µg

Opn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit
abx155143-01 96 Tests

Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details
Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit
abx155143-02 5x 96 Tests

Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details
Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit
abx155143-03 10x 96 Tests

Rat ADAM Metallopeptidase Domain 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details
TMEPAI (PMEPA1) (NM_001255976) Human Tagged ORF Clone
RC233576 10 µg

TMEPAI (PMEPA1) (NM_001255976) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Mesothelin (MSLN) Protein
abx067998-01 10 µg

Mouse Mesothelin (MSLN) Protein

Sign In for Pricing
View Details