Tpgs1 Peptide - middle region
Tpgs1 Peptide - middle region
Product Specifications
Product Name Alternative
AV005629, Gtrgeo22, PGs1, Tpgs1
UniProt
Q99MS8
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tpgs1 Rabbit Polyclonal Antibody (orb587186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_683736
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGIFRTGMLSC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C0105-02-AP 100 µL
CAD (Caspase Activated Deoxyribonuclease) (AP) discontinued
Sign In for Pricing
View Details 
abx009340-01 30 µL
Growth Arrest And DNA Damage-Inducible Protein GADD153 (GADD153) Antibody
Sign In for Pricing
View Details abx009340-02 100 µL
Growth Arrest And DNA Damage-Inducible Protein GADD153 (GADD153) Antibody
Sign In for Pricing
View Details