Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF8 Peptide - C-terminal region

DCAF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H326, WDR42A

UniProt

Q5TAQ9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF8 Rabbit Polyclonal Antibody (orb326961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056541

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PTP1B Antibody
MBS4507216-01 0.05 mL

Rabbit anti-PTP1B Antibody

Sign In for Pricing
View Details
Rabbit anti-PTP1B Antibody
MBS4507216-02 0.1 mL

Rabbit anti-PTP1B Antibody

Sign In for Pricing
View Details
Rabbit anti-PTP1B Antibody
MBS4507216-03 5x 0.1 mL

Rabbit anti-PTP1B Antibody

Sign In for Pricing
View Details
Il12b Antibody
orb1271128 0.1 mg

Il12b Antibody

Sign In for Pricing
View Details
GSK2850163 S enantiomer
T11489-01 10 mg

GSK2850163 S enantiomer

Sign In for Pricing
View Details
GSK2850163 S enantiomer
T11489-02 1 g

GSK2850163 S enantiomer

Sign In for Pricing
View Details