Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF8 Peptide - C-terminal region

DCAF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H326, WDR42A

UniProt

Q5TAQ9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF8 Rabbit Polyclonal Antibody (orb326961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056541

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ezrin Blocking Peptide
abx063419-01 1 mg

Ezrin Blocking Peptide

Sign In for Pricing
View Details
Ezrin Blocking Peptide
abx063419-02 5 mg

Ezrin Blocking Peptide

Sign In for Pricing
View Details
Smad3 Rat shRNA Plasmid (Locus ID 25631)
TR709691 1 Kit

Smad3 Rat shRNA Plasmid (Locus ID 25631)

Sign In for Pricing
View Details
1- (3,5-dichloropyridin-2-yl) -1,4-diazepane
sc-332703A 5 g

1- (3,5-dichloropyridin-2-yl) -1,4-diazepane

Sign In for Pricing
View Details
Rabbit Polyclonal SRRM2 Antibody [Janelia Fluor 549]
NBP3-05971JF549 0.1 mL

Rabbit Polyclonal SRRM2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
EIF1B Human shRNA Plasmid Kit (Locus ID 10289)
TR313268 1 Kit

EIF1B Human shRNA Plasmid Kit (Locus ID 10289)

Sign In for Pricing
View Details