Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB14 Peptide - N-terminal region

DNAJB14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EGNR9427, PRO34683

UniProt

Q8TBM8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJB14 Rabbit Polyclonal Antibody (orb587363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026893

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK2 Recombinant Mouse monoclonal Antibody
HA610080 100 µg

ERK2 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Slc24a2 Mouse Gene Knockout Kit (CRISPR)
KN515950 1 Kit

Slc24a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]
AM39020RP-N 100 Tests

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]

Sign In for Pricing
View Details
1-Phenethyl-2-pyridone
TRC-P321315-50MG 50 mg

1-Phenethyl-2-pyridone

Sign In for Pricing
View Details
3,7-Diisopropyl-3,7-diazabicyclo[3.3.1]nonan-9-one
TRC-D680265-10MG 10 mg

3,7-Diisopropyl-3,7-diazabicyclo[3.3.1]nonan-9-one

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808144 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details