DNAJB14 Peptide - N-terminal region
DNAJB14 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EGNR9427, PRO34683
UniProt
Q8TBM8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJB14 Rabbit Polyclonal Antibody (orb587363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001026893
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740029-100 1x 100 µL
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 