Ptpn7 Peptide - middle region
Ptpn7 Peptide - middle region
Product Specifications
Product Name Alternative
Heptp, Lcptp
UniProt
P49445
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ptpn7 Rabbit Polyclonal Antibody (orb331159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_663716
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Tide Quencher™ 2WS maleimide [TQ2WS maleimide]](https://cdn.genprice.uk/products/271/7359022/imageurl/2059-aat.webp)
AP01270PU-N 100 µg
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
AP26414AF-L 500 µg
FPRL1 (FPR2) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
