Ptpn7 Peptide - middle region
Ptpn7 Peptide - middle region
Product Specifications
Product Name Alternative
Heptp, Lcptp
UniProt
P49445
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ptpn7 Rabbit Polyclonal Antibody (orb331159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_663716
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FGFR1 Recombinant Rabbit Monoclonal Antibody [SD08-25]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81abf/imageurl/et1612-62.webp)
ET1612-62 100 µL
FGFR1 Recombinant Rabbit Monoclonal Antibody [SD08-25]
Sign In for Pricing
View Details 
LC401331 20 µg
FKBP51 (FKBP5) (NM_004117) Human Over-expression Lysate
Sign In for Pricing
View Details ![4-[(1,4-Dihydro-4-oxo-2-pyrimidinyl)amino]benzonitrile](https://cdn.genprice.uk/products/572/6410272164850/imageurl/trc-d449610-1g.webp)
TRC-D449610-1G 1 g
4-[(1,4-Dihydro-4-oxo-2-pyrimidinyl)amino]benzonitrile
Sign In for Pricing
View Details 