Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Efnb3 Peptide - C-terminal region

Efnb3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EFL-6, ELF-3, Elk-L3, Epl8, LERK-8, NLERK-2

UniProt

O35393

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Efnb3 Rabbit Polyclonal Antibody (orb585763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031937

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucochloric Acid
TRC-M790800-50G 50 g

Mucochloric Acid

Sign In for Pricing
View Details
Mouse CXCL9 Recombinant Rabbit monoclonal Antibody
HA725023 100 µL

Mouse CXCL9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Pepsin (PGA4) activation kit by CRISPRa
GA118710 1 Kit

Human Pepsin (PGA4) activation kit by CRISPRa

Sign In for Pricing
View Details
NDRG1 (NM_001135242) Human Over-expression Lysate
LY427604 100 µg

NDRG1 (NM_001135242) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Aminobenzonitrile
TRC-A591700-50G 50 g

2-Aminobenzonitrile

Sign In for Pricing
View Details
Uqcc2 Mouse Gene Knockout Kit (CRISPR)
KN518736 1 Kit

Uqcc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details