Efnb3 Peptide - C-terminal region
Efnb3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EFL-6, ELF-3, Elk-L3, Epl8, LERK-8, NLERK-2
UniProt
O35393
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Efnb3 Rabbit Polyclonal Antibody (orb585763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031937
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-P458665-5MG 5 mg
(3aR,4R,6R,7aS)-Pinanediol Ester Pyrrolidinyl Propan-1-one
Sign In for Pricing
View Details 
BNC742741-100 1x 100 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 