Ehd3 Peptide - C-terminal region
Ehd3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Ehd2
UniProt
Q8R491
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ehd3 Rabbit Polyclonal Antibody (orb586099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_620245
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-M1317-01 24 Tests
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
Sign In for Pricing
View Details E-EL-M1317-02 48 Tests
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
Sign In for Pricing
View Details E-EL-M1317-03 96 Tests
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
Sign In for Pricing
View Details 
