Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE12 Peptide - C-terminal region

PDE12 Peptide - C-terminal region

Product Specifications

UniProt

F6T1Q0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE12 Rabbit Polyclonal Antibody (orb582043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
E-UNEL-M0152-01 5x 96 Tests

Uncoated Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
E-UNEL-M0152-02 15x 96 Tests

Uncoated Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
(-)-3-Dehydro Shikimic Acid
TRC-D230475-25MG 25 mg

(-)-3-Dehydro Shikimic Acid

Sign In for Pricing
View Details
ZNF560 Human Gene Knockout Kit (CRISPR)
KN416811 1 Kit

ZNF560 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713537 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), 0.2mg/mL
BNUB1030-100 1x 100 µL

CD66 (CEA) (C66/1030), 0.2mg/mL

Sign In for Pricing
View Details