PDE12 Peptide - C-terminal region
PDE12 Peptide - C-terminal region
Product Specifications
UniProt
F6T1Q0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE12 Rabbit Polyclonal Antibody (orb582043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E894750-2G 2 g
Ethyl 2-Acetamido-2-deoxy-Beta-D-thioglucopyranoside
Sign In for Pricing
View Details 
LC404146 20 µg
Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Over-expression Lysate
Sign In for Pricing
View Details 