Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr26 Peptide - N-terminal region

Wdr26 Peptide - N-terminal region

Product Specifications

UniProt

B2RTG7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR26 Rabbit Polyclonal Antibody (orb585378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E,E)-1-Chloro-2,4-hexadiene
TRC-C368533-25MG 25 mg

(E,E)-1-Chloro-2,4-hexadiene

Sign In for Pricing
View Details
6-Amino-2-chloro-5-nitropyridine
TRC-A603495-25G 25 g

6-Amino-2-chloro-5-nitropyridine

Sign In for Pricing
View Details
DL-Ethyl Lactate
TRC-E921945-1G 1 g

DL-Ethyl Lactate

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6203
BIGP-6203 1 Unit

General Purpose Incubator BIGP-6203

Sign In for Pricing
View Details
GABRR3 (NM_001105580) Human Over-expression Lysate
LC426290 20 µg

GABRR3 (NM_001105580) Human Over-expression Lysate

Sign In for Pricing
View Details
FBLIM1 (NM_001024216) Human Over-expression Lysate
LC422623 20 µg

FBLIM1 (NM_001024216) Human Over-expression Lysate

Sign In for Pricing
View Details