TTC7A Peptide - N-terminal region
TTC7A Peptide - N-terminal region
Product Specifications
UniProt
F5H4E1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TTC7A Rabbit Polyclonal Antibody (orb325425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040502-100 1x 100 µL
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472308-100 1x 100 µL
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 