Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC7A Peptide - N-terminal region

TTC7A Peptide - N-terminal region

Product Specifications

UniProt

F5H4E1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC7A Rabbit Polyclonal Antibody (orb325425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nsg2 (NM_008741) Mouse Tagged ORF Clone
MG201438 10 µg

Nsg2 (NM_008741) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-01 50 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-02 100 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
APC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108E-03 2x 100 Tests

APC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
ChT1 Rabbit Polyclonal Antibody
HA500314 100 µL

ChT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706096 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details