KATNBL1 Peptide - N-terminal region
KATNBL1 Peptide - N-terminal region
Product Specifications
UniProt
Q9H079
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KATNBL1 Rabbit Polyclonal Antibody (orb326809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078989
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RTVGQTVKSPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472475-100 1x 100 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042062-500 1x 500 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941887-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details