Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC149 Peptide - C-terminal region

CCDC149 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZUS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC149 Rabbit Polyclonal Antibody (orb326849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775734

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAVNSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dvl-2 shRNA (m) Lentiviral Particles
sc-35231-V 200 µL

Dvl-2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
C22orf9 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9987R-BF555 100 µL

C22orf9 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal PHACTR4 Antibody
NBP1-82267-25ul 25 µL

Rabbit Polyclonal PHACTR4 Antibody

Sign In for Pricing
View Details
Rabbit Thyroid Stimulating Hormone (TSH)
RC-RB7018 96 Well

Rabbit Thyroid Stimulating Hormone (TSH)

Sign In for Pricing
View Details
Plpp2 (NM_015817) Mouse Tagged ORF Clone
MR203710 10 µg

Plpp2 (NM_015817) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ANTXR1 293 Cell Lysate
404937 0.1 mg

ANTXR1 293 Cell Lysate

Sign In for Pricing
View Details