Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC149 Peptide - C-terminal region

CCDC149 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZUS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC149 Rabbit Polyclonal Antibody (orb326849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775734

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAVNSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-4-phenyl-nicotinic acid
OR97812 1 g

2-Bromo-4-phenyl-nicotinic acid

Sign In for Pricing
View Details
C1orf98 Rabbit Polyclonal Antibody (APC-Cy7)
orb2509945 100 µL

C1orf98 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1)
310315-01 50 µL

CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1)

Sign In for Pricing
View Details
CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1)
310315-02 100 µL

CEACAM1 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, BGP, BGP1)

Sign In for Pricing
View Details
ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 550) discontinued
A3571-15B-ML550 100 µL

ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CtBP1 Rabbit mAb
C06027-20uL 20 µL

CtBP1 Rabbit mAb

Sign In for Pricing
View Details