Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD36 Peptide - C-terminal region

ANKRD36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ2430

UniProt

A6QL64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD36 Rabbit Polyclonal Antibody (orb587295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157787

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQSYHCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQENLNSHVLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholamban (PLN) (NM_002667) Human Over-expression Lysate
LY400944 100 µg

Phospholamban (PLN) (NM_002667) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ARHGAP23 activation kit by CRISPRa
GA111650 1 Kit

Human ARHGAP23 activation kit by CRISPRa

Sign In for Pricing
View Details
Viability PCR Starter Kit with PMAxxTM
#31075-X 1 Kit

Viability PCR Starter Kit with PMAxxTM

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3308), 0.2mg/mL
BNUB3308-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3308), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human/Mouse/Rat BMP-2 Protein
PKSR030454-01 20 µg

Recombinant Human/Mouse/Rat BMP-2 Protein

Sign In for Pricing
View Details
Recombinant Human/Mouse/Rat BMP-2 Protein
PKSR030454-02 100 µg

Recombinant Human/Mouse/Rat BMP-2 Protein

Sign In for Pricing
View Details