Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD36 Peptide - C-terminal region

ANKRD36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UNQ2430

UniProt

A6QL64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD36 Rabbit Polyclonal Antibody (orb587295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157787

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MQSYHCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQENLNSHVLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKRF (NM_017544) Human Over-expression Lysate
LC402598 20 µg

NKRF (NM_017544) Human Over-expression Lysate

Sign In for Pricing
View Details
CD70 Antibody
KC-7327-01 50 μL

CD70 Antibody

Sign In for Pricing
View Details
CD70 Antibody
KC-7327-02 100 µL

CD70 Antibody

Sign In for Pricing
View Details
CD70 Antibody
KC-7327-03 1 mL

CD70 Antibody

Sign In for Pricing
View Details
PCDHB8 Human Gene Knockout Kit (CRISPR)
KN418022 1 Kit

PCDHB8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIK3CD Human Gene Knockout Kit (CRISPR)
KN214047 1 Kit

PIK3CD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details