Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO4 Peptide - N-terminal region

ENO4 Peptide - N-terminal region

Product Specifications

UniProt

A6NNW6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO4 Rabbit Polyclonal Antibody (orb587378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPVPPPPPPPPPTKKKGQKPGRKDTITEKPIAPAEPVEPVLSGSMAIGAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Filip1 shRNA (UAS) - Lentiviral mouse Filip1 shRNA (UAS, iRFP) (25)
GTR15224858 1 Vial

Lentiviral mouse Filip1 shRNA (UAS) - Lentiviral mouse Filip1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ASAP3 Rabbit Polyclonal Antibody
TA344972 100 µL

ASAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hamster C-Reactive Protein (CRP) ELISA Kit
AE64604HA-01 48 Tests

Hamster C-Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details
Hamster C-Reactive Protein (CRP) ELISA Kit
AE64604HA-02 96 Tests

Hamster C-Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details
SPRR2E AAV Vector (Human) (CMV)
45390101 1 µg

SPRR2E AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Porcine Matrix Metalloproteinase 5 ELISA Kit
MBS008428-01 48 Well

Porcine Matrix Metalloproteinase 5 ELISA Kit

Sign In for Pricing
View Details