Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO4 Peptide - N-terminal region

ENO4 Peptide - N-terminal region

Product Specifications

UniProt

A6NNW6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENO4 Rabbit Polyclonal Antibody (orb587378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPVPPPPPPPPPTKKKGQKPGRKDTITEKPIAPAEPVEPVLSGSMAIGAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1699 Protein Vector (Rat) (pPB-N-His)
PV289015 500 ng

Olr1699 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
POT1 (Protection of Telomeres 1, DKFZp586D211, hPot1) (PE)
MBS6432358-01 0.1 mL

POT1 (Protection of Telomeres 1, DKFZp586D211, hPot1) (PE)

Sign In for Pricing
View Details
POT1 (Protection of Telomeres 1, DKFZp586D211, hPot1) (PE)
MBS6432358-02 5x 0.1 mL

POT1 (Protection of Telomeres 1, DKFZp586D211, hPot1) (PE)

Sign In for Pricing
View Details
Recombinant Parathymosin (PTMS)
SIPD408Mu02-01 10 µg

Recombinant Parathymosin (PTMS)

Sign In for Pricing
View Details
Recombinant Parathymosin (PTMS)
SIPD408Mu02-02 50 µg

Recombinant Parathymosin (PTMS)

Sign In for Pricing
View Details
Recombinant Parathymosin (PTMS)
SIPD408Mu02-03 200 µg

Recombinant Parathymosin (PTMS)

Sign In for Pricing
View Details