Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOM3 Peptide - C-terminal region

MYOM3 Peptide - C-terminal region

Product Specifications

UniProt

Q5VTT5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYOM3 Rabbit Polyclonal Antibody (orb587554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat anti-B burgdorleri antibody, BB-Ab ELISA Kit
GTR10467746 96 Well

Rat anti-B burgdorleri antibody, BB-Ab ELISA Kit

Sign In for Pricing
View Details
Daxx Rabbit mAb
E45R11679N-50 50 µL

Daxx Rabbit mAb

Sign In for Pricing
View Details
BCMA/Tnfrsf17 Rabbit Polyclonal Antibody
orb413029 100 µg

BCMA/Tnfrsf17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit
MBS7246669-01 48 Well

Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit

Sign In for Pricing
View Details
Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit
MBS7246669-02 96 Well

Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit

Sign In for Pricing
View Details
Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit
MBS7246669-03 5x 96 Well

Porcine AT-hook-containing transcription factor (AKNA) ELISA Kit

Sign In for Pricing
View Details