Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOM3 Peptide - C-terminal region

MYOM3 Peptide - C-terminal region

Product Specifications

UniProt

Q5VTT5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYOM3 Rabbit Polyclonal Antibody (orb587554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (Quinolin-2-yl) ethanone
BAA01147-01 0.5 g

1- (Quinolin-2-yl) ethanone

Sign In for Pricing
View Details
1- (Quinolin-2-yl) ethanone
BAA01147-02 5 g

1- (Quinolin-2-yl) ethanone

Sign In for Pricing
View Details
Dysprosium (III) Oxalate 99.99.0%
RE0630-01 5 g

Dysprosium (III) Oxalate 99.99.0%

Sign In for Pricing
View Details
Dysprosium (III) Oxalate 99.99.0%
RE0630-02 25 g

Dysprosium (III) Oxalate 99.99.0%

Sign In for Pricing
View Details
Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody [DyLight 594]
NBP3-00289DL594 0.1 mL

Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody [DyLight 594]

Sign In for Pricing
View Details
TRNAE1 3'UTR GFP Stable Cell Line
TU076728 1.0 mL

TRNAE1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details