Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab6b Peptide - C-terminal region

Rab6b Peptide - C-terminal region

Product Specifications

Product Name Alternative

9630015C03, AI844641, C330006L04Rik, D9Bwg0185e

UniProt

P61294

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rab6b Rabbit Polyclonal Antibody (orb586449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776142

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cd8a activation kit by CRISPRa
GA200644 1 Kit

Mouse Cd8a activation kit by CRISPRa

Sign In for Pricing
View Details
4’-Bromoacetophenone-d4
TRC-B679062-25MG 25 mg

4’-Bromoacetophenone-d4

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL
BNC940759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCUN1D2 (NM_001014283) Human Over-expression Lysate
LY423049 100 µg

DCUN1D2 (NM_001014283) Human Over-expression Lysate

Sign In for Pricing
View Details
4-(2-Nitrophenyl)morpholin-3-one
TRC-N926065-250MG 250 mg

4-(2-Nitrophenyl)morpholin-3-one

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF640R conjugate, 0.1mg/mL
BNC400201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details