Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRNP2 Peptide - C-terminal region

CSRNP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C12orf2, C12orf22, FAM130A1, PPP1R72, TAIP-12

UniProt

Q9H175

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSRNP2 Rabbit Polyclonal Antibody (orb587343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110436

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aldh18a1 (NM_153554) AAV Particle
MR210701A1V 250 µL

Mouse Aldh18a1 (NM_153554) AAV Particle

Sign In for Pricing
View Details
AIFM1 Antibody
GWB-MX363C 50 µg

AIFM1 Antibody

Sign In for Pricing
View Details
OPN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
34850061 1.0 µg DNA

OPN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRAF-Interacting Protein With FHA Domain-Containing Protein A (TIFA) Antibody
abx034432-01 80 µL

TRAF-Interacting Protein With FHA Domain-Containing Protein A (TIFA) Antibody

Sign In for Pricing
View Details
TRAF-Interacting Protein With FHA Domain-Containing Protein A (TIFA) Antibody
abx034432-02 400 µL

TRAF-Interacting Protein With FHA Domain-Containing Protein A (TIFA) Antibody

Sign In for Pricing
View Details
CDC5L Antibody
E95560 100 µg

CDC5L Antibody

Sign In for Pricing
View Details