KDELC2 Peptide - C-terminal region
KDELC2 Peptide - C-terminal region
Product Specifications
UniProt
Q7Z4H8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KDELC2 Rabbit Polyclonal Antibody (orb587478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_714916
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1974-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), 0.2mg/mL
Sign In for Pricing
View Details ![BTG2 Mouse Monoclonal Antibody [Clone ID: OTI2G5]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90825b/imageurl/cf808151.webp)
BNUB1684-500 1x 500 µL
P63 (Squamous, Basal & Myoepithelial Cell Marker), 0.2mg/mL
Sign In for Pricing
View Details 
![Human IL-15 Recombinant Rabbit Monoclonal Antibody [PSH04-19] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81521/imageurl/ha722102.webp)
HA722102 100 µL
Human IL-15 Recombinant Rabbit Monoclonal Antibody [PSH04-19] - BSA and Azide free (Capture)
Sign In for Pricing
View Details