Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC2 Peptide - C-terminal region

KDELC2 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z4H8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELC2 Rabbit Polyclonal Antibody (orb587478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714916

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 510 succinimidyl ester
1424-AAT 1 mg

IFluor® 510 succinimidyl ester

Sign In for Pricing
View Details
DNA Polymerase gamma (POLG) (NM_001126131) Human Over-expression Lysate
LY426664 100 µg

DNA Polymerase gamma (POLG) (NM_001126131) Human Over-expression Lysate

Sign In for Pricing
View Details
ARHGEF12 Antibody
8C18388-AAT 50 µg

ARHGEF12 Antibody

Sign In for Pricing
View Details
Human HIPK4 activation kit by CRISPRa
GA115629 1 Kit

Human HIPK4 activation kit by CRISPRa

Sign In for Pricing
View Details
14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody
AP06765PU-N 100 µg

14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: bilateral
CB508588 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details