CFAP300 Peptide - C-terminal region
CFAP300 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CILD38, C11orf70
UniProt
Q9BRQ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP300 Rabbit Polyclonal Antibody (orb326725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116319
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1271968-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
RBP5 cDNA Clone
Sign In for Pricing
View Details MBS1271968-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock
RBP5 cDNA Clone
Sign In for Pricing
View Details 
26312114 3x 1.0 µg
Larp6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details