INTS10 Peptide - C-terminal region
INTS10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C8orf35, INT10
UniProt
Q9NVR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS10 Rabbit Polyclonal Antibody (orb587466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060612
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACF
More Discoveries
Explore Other Products
Browse additional items from our catalog
KLW0037 96 Well
GENLISA™ Monkey Transforming Growth Factor 2 (TGF 2) ELISA
Sign In for Pricing
View Details 
499933 10 µg
DYRK3, Recombinant, Human, GST-Tag (Dual-Specificity Tyrosine- (Y) -Phosphorylation Regulated Kinase 3, RED, REDK, DYRK5) discontinued
Sign In for Pricing
View Details