Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS10 Peptide - C-terminal region

INTS10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C8orf35, INT10

UniProt

Q9NVR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS10 Rabbit Polyclonal Antibody (orb587466) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpin E3 Antibody / SERPINE3
RQ7610 100 µg

Serpin E3 Antibody / SERPINE3

Sign In for Pricing
View Details
GPR149 Antibody
E314745 100 µg - 200 µL

GPR149 Antibody

Sign In for Pricing
View Details
Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit
CSB-EL019250HU-01 24 Well

Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit

Sign In for Pricing
View Details
Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit
CSB-EL019250HU-02 96 Well

Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit

Sign In for Pricing
View Details
Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit
CSB-EL019250HU-03 5x 96 Well

Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit

Sign In for Pricing
View Details
Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit
CSB-EL019250HU-04 10x 96 Well

Human Rac GTPase-activating protein 1 (RACGAP1) ELISA kit

Sign In for Pricing
View Details