Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUX1 Peptide - N-terminal region

DUX1 Peptide - N-terminal region

Product Specifications

UniProt

O43812

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUX1 Rabbit Polyclonal Antibody (orb575660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036278

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laburnum anagyroides (Gold Chain) Immobilized Lectin -LAL-
AK-8101-1 1 mL/Kit

Laburnum anagyroides (Gold Chain) Immobilized Lectin -LAL-

Sign In for Pricing
View Details
F(ab')2 Sheep IgG (H&L) Antibody Pre-Adsorbed
TA398249 500 µg

F(ab')2 Sheep IgG (H&L) Antibody Pre-Adsorbed

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2781-A 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
NAT1 (NM_001160179) Human Over-expression Lysate
LC431835 20 µg

NAT1 (NM_001160179) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)
PDEH100820-01 20 µg

Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)
PDEH100820-02 100 µg

Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)

Sign In for Pricing
View Details