DUX1 Peptide - N-terminal region
DUX1 Peptide - N-terminal region
Product Specifications
UniProt
O43812
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUX1 Rabbit Polyclonal Antibody (orb575660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036278
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 488 Anti-Mouse CD172a/SIRPα Antibody[P84]](https://cdn.genprice.uk/products/763/68dd14ac061270361e7d2dff/imageurl/e-ab-f1286l.webp)
E-AB-F1286L-01 50 Tests
Elab Fluor® 488 Anti-Mouse CD172a/SIRPα Antibody[P84]
Sign In for Pricing
View Details E-AB-F1286L-02 100 Tests
Elab Fluor® 488 Anti-Mouse CD172a/SIRPα Antibody[P84]
Sign In for Pricing
View Details E-AB-F1286L-03 2x 100 Tests
Elab Fluor® 488 Anti-Mouse CD172a/SIRPα Antibody[P84]
Sign In for Pricing
View Details 
