Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACY3 Peptide - C-terminal region

ACY3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACY-3, HCBP1

UniProt

Q96HD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACY3 Rabbit Polyclonal Antibody (orb326433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FGFR3 protein (His tag)
PDEM100292-01 20 µg

Recombinant Mouse FGFR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FGFR3 protein (His tag)
PDEM100292-02 100 µg

Recombinant Mouse FGFR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FGFR3 protein (His tag)
PDEM100292-03 500 µg

Recombinant Mouse FGFR3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FGFR3 protein (His tag)
PDEM100292-04 1 mg

Recombinant Mouse FGFR3 protein (His tag)

Sign In for Pricing
View Details
Phospho-PP2A (Y307) Recombinant Rabbit Monoclonal Antibody [ST49-05]
ET1609-40 100 µL

Phospho-PP2A (Y307) Recombinant Rabbit Monoclonal Antibody [ST49-05]

Sign In for Pricing
View Details
ARID5A (NM_212481) Human Over-expression Lysate
LC403951 20 µg

ARID5A (NM_212481) Human Over-expression Lysate

Sign In for Pricing
View Details