Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACY3 Peptide - C-terminal region

ACY3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACY-3, HCBP1

UniProt

Q96HD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACY3 Rabbit Polyclonal Antibody (orb326433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS806074 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), 0.2mg/mL
BNUB3247-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), 0.2mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF640R conjugate, 0.1mg/mL
BNC402755-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ten1 activation kit by CRISPRa
GA208214 1 Kit

Mouse Ten1 activation kit by CRISPRa

Sign In for Pricing
View Details
SCEL (NM_003843) Human Recombinant Protein
TP307214 20 µg

SCEL (NM_003843) Human Recombinant Protein

Sign In for Pricing
View Details
STAT1 Antibody
KC-4310-01 50 μL

STAT1 Antibody

Sign In for Pricing
View Details