Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ3 Peptide - C-terminal region

MYOZ3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CS-3, CS3, FRP3

UniProt

Q8TDC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYOZ3 Rabbit Polyclonal Antibody (orb326589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_588612

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ridaforolimus, >80%
TRC-R495850-5MG 5 mg

Ridaforolimus, >80%

Sign In for Pricing
View Details
DARPP32 (PPP1R1B) Human Gene Knockout Kit (CRISPR)
KN400916 1 Kit

DARPP32 (PPP1R1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 0.2mg/mL
BNUB1819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 0.2mg/mL

Sign In for Pricing
View Details
RNF113B Antibody
KC-2803-01 50 μL

RNF113B Antibody

Sign In for Pricing
View Details
RNF113B Antibody
KC-2803-02 100 µL

RNF113B Antibody

Sign In for Pricing
View Details
RNF113B Antibody
KC-2803-03 1 mL

RNF113B Antibody

Sign In for Pricing
View Details