MYOZ3 Peptide - C-terminal region
MYOZ3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CS-3, CS3, FRP3
UniProt
Q8TDC0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYOZ3 Rabbit Polyclonal Antibody (orb326589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_588612
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP219087 200 Reactions
LINC00656 Human qPCR Primer Pair (NM_182535)
Sign In for Pricing
View Details 
PKSV030359 20 µg
Recombinant SARS-CoV-2 Spike S1+S2 ECD (L18F, D80A, D215G, ΔLAL242-244, R246I, K417N, E484K, N501Y, D614G, A701V) (His Tag), Biotinylated
Sign In for Pricing
View Details 
TRC-D462743-50MG 50 mg
6-(Dibutylamino)-2-naphthalenecarboxaldehyde
Sign In for Pricing
View Details ![Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81911/imageurl/et1610-34.webp)
ET1610-34 100 µL
Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]
Sign In for Pricing
View Details 