CCNYL1 Peptide - middle region
CCNYL1 Peptide - middle region
Product Specifications
UniProt
Q8N7R7
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCNYL1 Rabbit Polyclonal Antibody (orb587314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AELDFGEGEG HHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1249587-01 0.02 mg (E-Coli)
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomY (yomY)
Sign In for Pricing
View Details MBS1249587-02 0.1 mg (E-Coli)
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomY (yomY)
Sign In for Pricing
View Details MBS1249587-03 0.02 mg (Yeast)
Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomY (yomY)
Sign In for Pricing
View Details