Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNYL1 Peptide - middle region

CCNYL1 Peptide - middle region

Product Specifications

UniProt

Q8N7R7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNYL1 Rabbit Polyclonal Antibody (orb587314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AELDFGEGEG HHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyimide powder
FP181261-01 0.1 Kg

Polyimide powder

Sign In for Pricing
View Details
Polyimide powder
FP181261-02 0.25 kg

Polyimide powder

Sign In for Pricing
View Details
Polyimide powder
FP181261-03 0.5 Kg

Polyimide powder

Sign In for Pricing
View Details
Polyimide powder
FP181261-04 1 Kg

Polyimide powder

Sign In for Pricing
View Details
Polyimide powder
FP181261-05 2 Kg

Polyimide powder

Sign In for Pricing
View Details
ACSM4 (NM_001080454) Human Over-expression Lysate
LS341392 100 µg

ACSM4 (NM_001080454) Human Over-expression Lysate

Sign In for Pricing
View Details