CIR1 Peptide - middle region
CIR1 Peptide - middle region
Product Specifications
Product Name Alternative
CIR
UniProt
Q86X95
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CIR1 Rabbit Polyclonal Antibody (orb324493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004873
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2804088-01 48 Tests
Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit
Sign In for Pricing
View Details MBS2804088-02 96 Tests
Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit
Sign In for Pricing
View Details MBS2804088-03 5x 96 Tests
Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit
Sign In for Pricing
View Details MBS2804088-04 10x 96 Tests
Mouse Translationally-controlled tumor protein (TPT1) ELISA Kit
Sign In for Pricing
View Details EA0074BO-01 96 Well
Bovine Platelet-activating factor acetylhydrolase, PLA2G7 ELISA KIT
Sign In for Pricing
View Details