Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITRM1 Peptide - N-terminal region

PITRM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MP1, PreP

UniProt

E7ES23

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITRM1 Rabbit Polyclonal Antibody (orb581678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229238

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF8 sgRNA CRISPR Lentivector (Human) (Target 3)
K2154904 1.0 µg DNA

SLAMF8 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
pcDNA3.1-Olr1-Myc Plasmid
PVTB50030-2a 2 µg

pcDNA3.1-Olr1-Myc Plasmid

Sign In for Pricing
View Details
Thyroxine (T4) (MaxLight 650)
227188-ML650 100 µL

Thyroxine (T4) (MaxLight 650)

Sign In for Pricing
View Details
pLVshRNA-U6-ZNF503-shRNA2-PGK-EGFP-T2A-Puro Plasmid
PVT31683 2 µg

pLVshRNA-U6-ZNF503-shRNA2-PGK-EGFP-T2A-Puro Plasmid

Sign In for Pricing
View Details
Rat Enolase ELISA Kit
MBS3807720-01 48 Well

Rat Enolase ELISA Kit

Sign In for Pricing
View Details
Rat Enolase ELISA Kit
MBS3807720-02 96 Well

Rat Enolase ELISA Kit

Sign In for Pricing
View Details