Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITRM1 Peptide - N-terminal region

PITRM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MP1, PreP

UniProt

E7ES23

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITRM1 Rabbit Polyclonal Antibody (orb581678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229238

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Gastric Inhibitory Polypeptide (GIP) ELISA Kit
NSL0389Ca 96 Tests

Canine Gastric Inhibitory Polypeptide (GIP) ELISA Kit

Sign In for Pricing
View Details
ZNF133 sgRNA CRISPR Lentivector set (Human)
K2687801 3x 1.0 µg

ZNF133 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
5x Hot Start ZipTaq Kit
HS324 500x 25 µL Reactions

5x Hot Start ZipTaq Kit

Sign In for Pricing
View Details
FABP4 (Fatty Acid-binding Protein, Adipocyte, Adipocyte Lipid-binding Protein, ALBP, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4)
140213 200 µL

FABP4 (Fatty Acid-binding Protein, Adipocyte, Adipocyte Lipid-binding Protein, ALBP, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4)

Sign In for Pricing
View Details
2-Nitro-5-piperidinobenzenecarboxamide
sc-308499A 5 mg

2-Nitro-5-piperidinobenzenecarboxamide

Sign In for Pricing
View Details
Cathepsin D (CTSD) Antibody
abx111443 100 µL

Cathepsin D (CTSD) Antibody

Sign In for Pricing
View Details