BDNF Peptide - N-terminal region
BDNF Peptide - N-terminal region
Product Specifications
UniProt
P23560
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BDNF Rabbit Polyclonal Antibody (orb578293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-IL18BP-Hu-01 96 Tests
Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit
Sign In for Pricing
View Details RDR-IL18BP-Hu-02 48 Tests
Human Interleukin 18 Binding Protein (IL18BP) ELISA Kit
Sign In for Pricing
View Details 
LC429663 20 µg
Cofilin 2 (CFL2) (NM_021914) Human Over-expression Lysate
Sign In for Pricing
View Details