BDNF Peptide - N-terminal region
BDNF Peptide - N-terminal region
Product Specifications
UniProt
P23560
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BDNF Rabbit Polyclonal Antibody (orb578293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1964-500 1x 500 µL
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]](https://cdn.genprice.uk/products/937/68dd1b76061270361ea1a3cc/imageurl/ta800675am.webp)
TA800675AM 100 µL
Tpit (TBX19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
Sign In for Pricing
View Details 
