ZSCAN5C Peptide - middle region
ZSCAN5C Peptide - middle region
Product Specifications
Product Name Alternative
ZSCAN5CP
UniProt
A6NGD5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSCAN5C Rabbit Polyclonal Antibody (orb325649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403247-100 1x 100 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY420113 100 µg
gamma Adaptin (AP1G1) (NM_001128) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC401812-100 1x 100 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 