ZSCAN5C Peptide - middle region
ZSCAN5C Peptide - middle region
Product Specifications
Product Name Alternative
ZSCAN5CP
UniProt
A6NGD5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSCAN5C Rabbit Polyclonal Antibody (orb325649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI12C6]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908f0c/imageurl/cf813255.webp)
CF813255 100 µg
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI12C6]
Sign In for Pricing
View Details ![OBFC1 (STN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]](https://cdn.genprice.uk/products/937/68dd1b6b061270361ea164fc/imageurl/ta503274bm.webp)
TA503274BM 100 µL
OBFC1 (STN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]
Sign In for Pricing
View Details 
BNC040855-500 1x 500 µL
Retinol Binding Protein-1 (G4E4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details